Lecture 2: Biology Basics Con4nued Central Dogma DNA: The - - PowerPoint PPT Presentation

Lecture ¡2: ¡Biology ¡Basics ¡Con4nued ¡

Central ¡Dogma ¡

DNA: ¡The ¡Code ¡of ¡Life ¡

• The ¡structure ¡and ¡the ¡four ¡genomic ¡le=ers ¡code ¡for ¡

all ¡living ¡organisms ¡ ¡

• Adenine, ¡Guanine, ¡Thymine, ¡and ¡Cytosine ¡which ¡pair ¡

A-­‑T ¡and ¡C-­‑G ¡on ¡complimentary ¡strands. ¡

• DNA ¡has ¡a ¡double ¡helix ¡

structure ¡which ¡ composed ¡of ¡ ¡ ¡

– sugar ¡molecule ¡ – phosphate ¡group ¡ – and ¡a ¡base ¡(A,C,G,T) ¡

¡

• DNA ¡always ¡reads ¡from ¡

5’ ¡end ¡to ¡3’ ¡end ¡for ¡ transcrip4on ¡replica4on ¡ ¡

DNA: ¡The ¡Code ¡of ¡Life ¡

DNA ¡Replica4on ¡

• DNA ¡can ¡replicate ¡by ¡

spliLng, ¡and ¡rebuilding ¡ each ¡strand. ¡

• Note ¡that ¡the ¡rebuilding ¡
• f ¡each ¡strand ¡uses ¡

slightly ¡different ¡ mechanisms ¡due ¡to ¡the ¡ 5’ ¡3’ ¡asymmetry, ¡but ¡ each ¡daughter ¡strand ¡is ¡ an ¡exact ¡replica ¡of ¡the ¡

• riginal ¡strand. ¡

¡

http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/D/DNAReplication.html

Inverse ¡Complement ¡of ¡DNA ¡

What ¡is ¡the ¡inverse ¡complement ¡sequence ¡of ¡ TATAGCCCG? ¡

Inverse ¡Complement ¡of ¡DNA ¡

What ¡is ¡the ¡inverse ¡complement ¡sequence ¡of ¡ TATAGCCCG? ¡ ¡CGGGCTATA ¡

Genotype/Phenotype ¡

• To ¡prevent ¡confusion ¡between ¡genes ¡(which ¡

are ¡inherited) ¡and ¡developmental ¡outcomes ¡ (which ¡are ¡not), ¡gene4cists ¡make ¡a ¡dis4nc4on ¡ between ¡the ¡genotype ¡and ¡the ¡phenotype ¡of ¡ an ¡organism ¡

– Genotype: ¡complete ¡set ¡of ¡genes ¡inherited ¡by ¡an ¡ individual ¡ ¡ – Phenotype: ¡all ¡aspects ¡of ¡the ¡individual’s ¡ physiology, ¡behavior, ¡and ¡ecological ¡rela4onships ¡

DNA ¡the ¡Gene4cs ¡Makeup ¡

• Genes ¡are ¡inherited ¡and ¡

are ¡expressed ¡

• genotype ¡(gene4c ¡

makeup) ¡

• phenotype ¡(physical ¡

expression) ¡

On ¡the ¡leX, ¡is ¡the ¡eye’s ¡phenotypes ¡of ¡green ¡and ¡black ¡eye ¡genes. ¡

• Two ¡organisms ¡whose ¡genes ¡differ ¡at ¡one ¡

locus ¡are ¡said ¡to ¡have ¡different ¡genotypes. ¡

• A ¡locus ¡(loci ¡for ¡plural) ¡is ¡the ¡specific ¡loca4on ¡
• f ¡a ¡gene ¡of ¡a ¡DNA ¡sequence ¡on ¡a ¡
• chromosome. ¡
• A ¡variant ¡of ¡the ¡DNA ¡sequence ¡at ¡a ¡given ¡

loca4on ¡is ¡called ¡a ¡allele. ¡

• The ¡ordered ¡list ¡of ¡loci ¡known ¡for ¡a ¡par4cular ¡

genome ¡is ¡called ¡a ¡gene4c ¡map. ¡ ¡

Diploid ¡and ¡polyploid ¡cells ¡whose ¡chromosomes ¡have ¡the ¡same ¡ allele ¡of ¡a ¡given ¡gene ¡at ¡some ¡locus ¡are ¡called ¡homozygous, ¡with ¡ respect ¡to ¡that ¡gene ¡(otherwise, ¡it ¡is ¡heterzygous). ¡ The ¡chromosomal ¡locus ¡of ¡a ¡ gene ¡might ¡be ¡wri=en ¡"6p21.3” ¡

• 6: ¡chromosome ¡number ¡
• p: ¡posi4on ¡on ¡the ¡

chromosome’s ¡short ¡arm ¡ (“p”) ¡or ¡long ¡arm ¡(“q”) ¡

• 21.3: ¡the ¡posi4on ¡on ¡the ¡

arm: ¡region ¡2, ¡band ¡1, ¡sub-­‑ band ¡3. ¡The ¡bands ¡are ¡visible ¡ under ¡a ¡microscope ¡when ¡ the ¡chromosome ¡is ¡stained. ¡

¡

Genotype/Phenotype ¡

Phenotype: ¡ ¡ Blue ¡eyes ¡ Brown ¡eyes ¡ Genotype: ¡ ¡ Recessive: ¡bb ¡ Dominant: ¡Bb ¡or ¡BB ¡

• Genes ¡are ¡shown ¡in ¡rela4ve ¡order ¡and ¡

distance ¡from ¡each ¡other ¡based ¡on ¡pedigree ¡

• studies. ¡
• The ¡chance ¡of ¡the ¡chromosome ¡breaking ¡

between ¡A ¡& ¡C ¡is ¡higher ¡than ¡the ¡chance ¡of ¡ the ¡chromosome ¡breaking ¡between ¡A ¡& ¡B ¡ during ¡meiosis ¡

• Similarly, ¡the ¡chance ¡of ¡the ¡chromosome ¡

breaking ¡between ¡E ¡& ¡F ¡is ¡higher ¡than ¡the ¡ chance ¡of ¡the ¡chromosome ¡breaking ¡ between ¡F ¡& ¡G ¡

• The ¡closer ¡two ¡genes ¡are, ¡the ¡more ¡likely ¡

they ¡are ¡to ¡be ¡inherited ¡together ¡(co-­‑

• ccurrence) ¡
• If ¡pedigree ¡studies ¡show ¡a ¡high ¡incidence ¡of ¡

co-­‑occurrence, ¡those ¡genes ¡will ¡be ¡located ¡ close ¡together ¡on ¡a ¡gene4c ¡map ¡

• Pleiotropy: ¡when ¡one ¡gene ¡affects ¡many ¡

different ¡traits. ¡

• Polygenic ¡traits: ¡when ¡one ¡trait ¡is ¡governed ¡by ¡

mul4ple ¡genes, ¡which ¡maybe ¡on ¡the ¡same ¡ chromosome ¡or ¡on ¡different ¡chromosomes. ¡ ¡

– The ¡addi4ve ¡effects ¡of ¡numerous ¡genes ¡on ¡a ¡single ¡ phenotype ¡create ¡a ¡con4nuum ¡of ¡possible ¡

• utcomes. ¡ ¡

– Polygenic ¡traits ¡are ¡also ¡most ¡suscep4ble ¡to ¡ environmental ¡influences. ¡ ¡

Pleiotropy ¡in ¡humans: ¡Phenylketonuria ¡ ¡

A ¡disorder ¡that ¡is ¡caused ¡by ¡a ¡deficiency ¡of ¡the ¡enzyme ¡ phenylalanine ¡hydroxylase, ¡which ¡is ¡necessary ¡to ¡convert ¡the ¡ essen4al ¡amino ¡acid ¡phenylalanine ¡to ¡tyrosine. ¡ ¡ A ¡defect ¡in ¡the ¡single ¡gene ¡ that ¡codes ¡for ¡this ¡enzyme ¡ therefore ¡results ¡in ¡the ¡ mul4ple ¡phenotypes ¡ associated ¡with ¡PKU, ¡ including ¡mental ¡retarda4on, ¡ eczema, ¡and ¡pigment ¡defects ¡ that ¡make ¡affected ¡ individuals ¡lighter ¡skinned ¡ ¡

Polygenic ¡Inheritance ¡in ¡Humans ¡

• Height ¡is ¡controlled ¡by ¡polygenes ¡for ¡skeleton ¡height, ¡but ¡their ¡

effect ¡may ¡be ¡affected ¡by ¡malnutri4on, ¡injury, ¡and ¡disease. ¡

• Weight, ¡skin ¡color, ¡and ¡intelligence. ¡
• Birth ¡defects ¡like ¡clubfoot, ¡cleX ¡palate, ¡or ¡neural ¡tube ¡defects ¡are ¡

also ¡the ¡result ¡of ¡mul4ple ¡gene ¡interac4ons. ¡

• Complex ¡diseases ¡and ¡traits ¡have ¡a ¡tendency ¡to ¡have ¡low ¡

heritability ¡(tendency ¡to ¡be ¡inherited) ¡compared ¡to ¡single ¡gene ¡ disorders ¡(i.e. ¡sickle-­‑cell ¡anemia, ¡cys4c ¡fibrosis, ¡PKU, ¡Hemophelia, ¡ many ¡extremely ¡rare ¡gene4c ¡disorders). ¡

¡

Selec4on ¡

• Some ¡genes ¡may ¡be ¡subject ¡to ¡selec4on, ¡where ¡

individuals ¡with ¡advantages ¡or ¡“adap4ve” ¡traits ¡ tend ¡to ¡be ¡more ¡successful ¡than ¡their ¡peers ¡ reproduc4vely ¡

• When ¡these ¡traits ¡have ¡a ¡gene4c ¡basis, ¡selec4on ¡

can ¡increase ¡the ¡prevalence ¡of ¡those ¡traits, ¡ because ¡the ¡offspring ¡will ¡inherit ¡those ¡traits. ¡ This ¡may ¡correlate ¡with ¡the ¡organism's ¡ability ¡to ¡ survive ¡in ¡its ¡environment. ¡

• Several ¡different ¡genotypes ¡(and ¡possibly ¡

phenotypes) ¡may ¡then ¡coexist ¡in ¡a ¡popula4on. ¡In ¡ this ¡case, ¡their ¡gene4c ¡differences ¡are ¡called ¡

• polymorphisms. ¡

Gene4c ¡Muta4on ¡

• The ¡simplest ¡is ¡the ¡point ¡muta4on ¡or ¡subs4tu4on; ¡here, ¡a ¡single ¡

nucleo4de ¡in ¡the ¡genome ¡is ¡changed ¡(single ¡nucleo4de ¡ polymorphisms ¡(SNPs)) ¡

• Other ¡types ¡of ¡muta4ons ¡include ¡the ¡following: ¡

– Inser4on. ¡A ¡piece ¡of ¡DNA ¡is ¡inserted ¡into ¡the ¡genome ¡at ¡a ¡ certain ¡posi4on ¡ – Dele4on. ¡A ¡piece ¡of ¡DNA ¡is ¡cut ¡from ¡the ¡genome ¡at ¡a ¡certain ¡ posi4on ¡ – Inversion. ¡A ¡piece ¡of ¡DNA ¡is ¡cut, ¡flipped ¡around ¡and ¡then ¡re-­‑ inserted, ¡thereby ¡conver4ng ¡it ¡into ¡its ¡complement ¡ – Transloca4on. ¡A ¡piece ¡of ¡DNA ¡is ¡moved ¡to ¡a ¡different ¡posi4on. ¡ – Duplica4on. ¡A ¡copy ¡of ¡a ¡piece ¡of ¡DNA ¡is ¡inserted ¡into ¡the ¡ genome ¡

Muta4ons ¡and ¡Selec4on ¡

• While ¡muta4ons ¡can ¡be ¡detrimental ¡to ¡the ¡

affected ¡individual, ¡they ¡can ¡also ¡in ¡rare ¡cases ¡be ¡ beneficial; ¡more ¡frequently, ¡neutral. ¡

• OXen ¡muta4ons ¡have ¡no ¡or ¡a ¡negligible ¡impact ¡
• n ¡survival ¡and ¡reproduc4on. ¡
• Thereby ¡muta4ons ¡can ¡increase ¡the ¡gene4c ¡

diversity ¡of ¡a ¡popula4on, ¡that ¡is, ¡the ¡number ¡of ¡ present ¡polymorphisms. ¡ ¡

• In ¡combina4on ¡with ¡selec4on, ¡this ¡allow ¡a ¡

species ¡to ¡adapt ¡to ¡changing ¡environmental ¡ condi4ons ¡and ¡to ¡survive ¡in ¡the ¡long ¡term. ¡

Raw ¡Sequence ¡Data ¡

• 4 ¡bases: ¡A, ¡C, ¡G, ¡T ¡+ ¡other ¡(i.e. ¡N ¡= ¡any, ¡R ¡= ¡G ¡or ¡A ¡

(purine), ¡Y ¡= ¡T ¡or ¡(pyrimidine)) ¡

– kb ¡(= ¡kbp) ¡= ¡kilo ¡base ¡pairs ¡= ¡1,000 ¡bp ¡ – Mb ¡= ¡mega ¡base ¡pairs ¡= ¡1,000,000 ¡bp ¡ ¡ – Gb ¡= ¡giga ¡base ¡pairs ¡= ¡1,000,000,000 ¡bp. ¡

• Size:

¡ ¡ – E. ¡Coli ¡4.6Mbp ¡(4,600,000) ¡ – Fish ¡130 ¡Gbp ¡(130,000,000,000) ¡ – Paris ¡japonica ¡(Plant) ¡150 ¡Gbp ¡ – Human ¡3.2Gbp ¡ ¡

Fasta ¡File ¡

• A ¡sequence ¡in ¡FASTA ¡format ¡begins ¡with ¡a ¡single-­‑line ¡

descrip4on, ¡followed ¡by ¡lines ¡of ¡sequence ¡data ¡(file ¡extension ¡ is ¡.fa). ¡ ¡

• It ¡is ¡recommended ¡that ¡all ¡lines ¡of ¡text ¡be ¡shorter ¡than ¡80 ¡

characters ¡in ¡length. ¡

Fastq ¡File ¡

• Typically ¡contain ¡4 ¡lines: ¡

– Line ¡1 ¡begins ¡with ¡a ¡'@' ¡character ¡and ¡is ¡followed ¡by ¡a ¡sequence ¡ iden4fier ¡and ¡an ¡op#onal ¡descrip4on. ¡ – Line ¡2 ¡is ¡the ¡sequence. ¡ – Line ¡3 ¡is ¡the ¡delimiter ¡‘+’, ¡with ¡an ¡op4onal ¡descrip4on. ¡ – Line ¡4 ¡is ¡the ¡quality ¡score. ¡ – file ¡extension ¡is ¡.fq ¡

@SEQ_ID GATTTGGGGTTCAAAGCTTCAAAGCTTCAAAGC + !''*((((***+))%%%++++++++!!!++***

Proteins: ¡Primary ¡Structure ¡

• Pep4de ¡sequence: ¡

– Sequence ¡of ¡amino ¡acids ¡= ¡sequences ¡from ¡a ¡20 ¡ le=er ¡alphabet ¡(i.e. ¡ACDEFGHIKLMNPQRSTVWY) – Average ¡protein ¡has ¡~300 ¡amino ¡acids ¡ – Typically ¡stored ¡as ¡fasta ¡files ¡

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY

Proteins: ¡Secondary ¡Structure ¡

• Polypep4de ¡chains ¡fold ¡into ¡regular ¡local ¡

structures ¡

– Common ¡types: ¡alpha ¡helix, ¡beta ¡sheet, ¡turn, ¡loop ¡ – Defined ¡by ¡the ¡crea4on ¡of ¡hydrogen ¡bonds ¡

Proteins: ¡Ter4ary ¡Structure ¡

• 3D ¡structure ¡of ¡a ¡polypep4de ¡sequence ¡

– interac4ons ¡between ¡non-­‑local ¡and ¡ ¡ foreign ¡atoms ¡

Proteins: ¡Quaternary ¡Structure ¡

• Arrangement ¡of ¡protein ¡subunits ¡

Genes ¡and ¡Proteins ¡

• One ¡gene ¡encodes ¡one ¡protein ¡and ¡begins ¡with ¡

start ¡codon ¡(e.g. ¡ATG), ¡then ¡each ¡three ¡code ¡one ¡ amino ¡acid. ¡Then ¡a ¡stop ¡codon ¡(e.g. ¡TGA) ¡signifies ¡ end ¡of ¡the ¡gene. ¡

• In ¡the ¡middle ¡of ¡a ¡(eukaryo4c) ¡gene, ¡there ¡are ¡

segments ¡that ¡are ¡spliced ¡out ¡during ¡

• transcrip4on. ¡ ¡

– Introns: ¡segments ¡that ¡are ¡spliced ¡out ¡ ¡ – Exons: ¡segments ¡that ¡are ¡kept. ¡

• Detec4ng ¡the ¡introns ¡and ¡exons ¡is ¡a ¡task ¡for ¡gene ¡
• finding. ¡

Genomics: ¡

• ­‑

Assembly ¡ ¡

• ­‑

Detec4on ¡of ¡varia4on ¡

• ­‑

GWAS ¡ RNA: ¡

• ­‑

Gene ¡expression ¡

• ­‑

Transcriptome ¡assembly ¡ ¡

• ­‑

Pathway ¡analysis ¡ Protein: ¡

• ­‑

Mass ¡spectrometry ¡

• ­‑

Structure ¡predic4on ¡ ¡

• ­‑

Protein-­‑Protein ¡ interac4on ¡ ¡