Tropism Testing with XTrack C Heinz Stucki Institut fr med. - - PowerPoint PPT Presentation
Tropism Testing with XTrack C Heinz Stucki Institut fr med. - - PowerPoint PPT Presentation
Tropism Testing with XTrack C Heinz Stucki Institut fr med. Mikrobiologie Universitt Basel Introduction Genotyping: typically at amino acid level CTRPSNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC e.g. 11/25 and G2P XTrack C : at nucleic acid
Introduction
- Genotyping:
typically at amino acid level
CTRPSNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC
- XTrackC: at nucleic acid level
TGTACAAGACCCAGCAACAATACAAGAAAAAGTATACATATAGGACCAGGGAGAGCATTTTATACAACAGGAGAAATAATAGGAGATATAAGACAAGCACATTGT
Hybridization to R5 reference sequence
Level of hybridization determines formation of different structures
- resolved by capillary electrophoresis
Homoduplex Heteroduplex e.g. 11/25 and G2P
Validation
- Study of SHCS: samples for validation: 100
- Scheme for diagnostic Co-receptor assignment
clear assignment with XTrackC 1-2 days ambiguities analyzed by genotyping (eg. 11/25, G2P) 2 days ambiguities analyzed by Phenotyping (rPheno) 3 Weeks
- Comparison of results with Trofile assay
Phylogenetic tree of HIV1 DNA sequences
Source: Los Alamos database 2008
blue: R5 tropic red: X4 tropic
- 5 main lobes
- X4 strains more outside
- some lobes show X4 clusters
- closely related?
- dual?
Probe design
Dendrogram synthesis of four specific R5-probes Representation
BUT to date:
- no general representation in Los Alamos DB!
- “Sequences of interest” seem predominant
more “real life material” needed!
Profile of patient’s virus Results for R5 or X4 tropic viruses / mixed populations
homoduplex MW ss probe
CCR5 tropic CXCR4 tropic Mixed population
heteroduplex MW ss probe ss probe heteroduplex MW homoduplex
R5-window
Issues Example for a sample with strange migration
Heteroduplex peak located in unexpected position Co-receptor tropism not assignable
ss probe heteroduplex homoduplex MW
- 1. Samples of “non assignable tropism”
- => sequencing
- => analyze with 11/25 or Geno2Pheno
Collaborators invited!
- 2. discordant cases; MRV resistance
- expected only for low no. of samples
- Phenotyping with rPheno
- 3. Aspects of viral fitness
- rPheno in presence of drug
Limits of XTrackC
Tropism Quiz
Patient 9 0 2 N.A. R5 R5 5 0 8 X4 X4 X4 8 1 2 R5 R5 R5 9 1 6 R5 X4 X4 6 9 6 R5 R5 X4 4 0 8 R5 X4 X4 1 6 8 R5 R5 R5 7 2 4 R5 X4 X4 4 0 4 R5 R5 N.A. 1 6 4 R5 X4 R5 1 7 2 N.A. R5 X4 1 6 1 R5 R5 X4 1 5 2 R5 X4 N.A. 7 1 5 R5 R5 X4 7 1 8 N.A. X4 X4 4 1 3 R5 R5 R5 4 0 7 R5 R5 N.A. 1 2 R5 R5 X4 1 7 X4 X4 R5 7 3 1 R5 X4 X4
who is who?
Summary XTrackC
- combines genotypic and structural information
- fast and cost-effective
- detects mixed populations
- serves as starting point for genotyping
- Rapid system turn-around 2d / +3d / +14d
XtrackC / geno / pheno
Acknowledgment
Thomas Klimkait Sarah Wagner Sevèrine Louvel
Institut für medizinische Mikrobiologie
François Hamy Vincent Vidal
Principle of rPheno
Reporter read-out
env
Inhibitor Inhibitor R5 R5
Virus Reconstitution (Plasmid) Amplification / Reinfection Patient virus Phenotype Genotype Geno2Pheno XTrackC read-out
Inhibitor Inhibitor X4 X4
amplification