Interpretation tools for coreceptor usage Rolf Kaiser Institute of - - PowerPoint PPT Presentation
Interpretation tools for coreceptor usage Rolf Kaiser Institute of - - PowerPoint PPT Presentation
Interpretation tools for coreceptor usage Rolf Kaiser Institute of Virology University of Cologne Coreceptor Usage 2 Chemokinreceptors are used in vivo as coreceptors: CCR5 & CXCR4 CCR5 only (R5-Virus) CXCR4 only (X4-Virus)
Coreceptor Usage
2 Chemokinreceptors are used in vivo as coreceptors: CCR5 & CXCR4 CCR5 only (R5-Virus) CXCR4 only (X4-Virus) Viruses using CCR5 and CXCR4 (R5/X4-Virus, dualtropic) Mixtures of R5- and X4-Viruses in patients plasma (Mixed) For clinical purpose 2 classes: CXCR4 can be used CXCR4 cannot be used => R5 viruses that can be inhibited by R5-blockers
HIV Entry Cell Assay (Trofile)
Adapted from Petropoulos CJ, et al. Antimicrob Agents Chemother. 2000;44:920-8.
Transfection
HIV env expression vector
+ + +
HIV genomic luc vector CD4 + CXCR4 +
Infection
Pseudovirus
- capable of a single
round of replication
R5/X4 Tropic HIV
CCR5 and CXCR4 antagonists are used to confirm tropism
CD4 + CCR5 +
deCIPhR for Entry inhibitors
β-Gal
Pr
X4 Env T20 TF141-1
- Cpd. conc. (nM)
0.1 10 1000
- Av. %Inh.
- 20
20 40 60 80 100 X4-3026 AMD3100
- Cpd. conc. (nM)
0.01 1 100
- 20
20 40 60 80 100 SCH417690 TAK779
- Cpd. conc. (nM)
0.01 1 100 % virus inhibition
- 20
20 40 60 80 100
Fusion Inhibitors CXCR4-antagonists CCR5-antagonists
T20 TF141-1
- Cpd. conc. (nM)
0.1 10 1000
- Av. %Inh.
- 20
20 40 60 80 100 SCH417690 TAK779
- Cpd. conc. (nM)
0.01 1 100
- Av. %Inh.
- 20
20 40 60 80 100 AMD3100 X4-3026
- Cpd. conc. (nM)
0.1 10 1000
- Av. %Inh.
- 20
20 40 60 80 100
β-Gal
Pr
R5 Env
HIV-1 PHENOSCRIPT-ENV
EUROFINS-TRT Data presented from JL Faudon
Comparison of different phenotypic assays
Monogram-Trofile Eurofins-TRT R5 X4 R5 n=42 (56,8%) n=3 (4.1%) X4 n=8 (10%) n=21 (28,4%)
Skrabal et al J. Clin. Microbiol, 2007
14% discordant; different cell lines, other differences?
Questions
Predicting coreceptor usage by genotypic analyses? Can we simply adapt our experience from resistance testing of RT and Protease? What gene(-region) to sequence? aa position 11 and 25 in env-V3 are predictive enough for R5/X4 (SI/NSI) (Fouchier et al 1995)
6558 TGGGATCAAAGCCTAAAGCCATGTG
GGGTTCTTRGGAGCAGCAGGAAGCACT 7785
6957 GTACAATGTACACATGGAAT
TAATTGTGGAGGGGAATTTT 7371
V3 Izopet et al. Lehmann et al.
1110 matched genotype (V3 region)-phenotype pairs:
Genotypic Monitoring of Coreceptor Usage
CTRPNNNTRRSISIGPGRAFYATGDIIGDIRQAHC R5 CTRPNNNTRKGIHMGPGS-FYVTGEIIGDIRQAHC R5
phenotyping genotyping
CSRPNNNTRKSVHIGPGQAFYATGDVIGDIRQAHC X4
X=(X1, …, Xi, …, Xn) Y
multiple alignment (against fixed reference alignment) statistical learning
T.Sing
Internet-Tools for genotype based predictions
Web-PSSM (Mark Jensen et al),http://ubik.microbiol.washington.edu/computing/pssm/ PSSMs for Subtyp B vs. C* WetCat: (Pillai et al.)http://genomiac2.ucsd.edu:8080/wetcat/v3.html geno2pheno[coreceptor] http://www.genafor.org
geno2pheno[coreceptor]
Current geno2pheno[coreceptor]: Specificity 90%, Sensitivity 76% for X4 trained on 1100 Los Alamos data
Geno2pheno[coreceptor]: Output
Alignment relative to HXB2 Predicted coreceptor usage
Question
Other attributes ?
Gp120 and V3 region
geno2pheno[coreceptor] For 90% Spec. for X4 Sensitivities are SVM-Seq: 79.4%
SVM-struct. descriptors 84,7% SVM-Seq+ struct. descriptors 86,4%. Poster #66 – O. Sander
Genotyping results
- Salvage Patients Uni Köln,
longitudinal study over 3 years
C.Lehmann, G.Fätkenheuer, M.Däumer, R.Kaiser, Journal of Clinical Virology 37 (2006) 300–304
- Successful Amplification in 45 /45 patients (100%)
- Interpretation with geno2pheno in 42/45
25 patients (56%) contiunously displayed an R5-Virus 12 patients (27%) contiunously displayed an X4-Virus In1 patient HIV ‚shifted‘ from R5 to X4 In 2 patients HIV ‚shifted‘ from X4 to R5 In 1 patient HIV ‚shifted‘ from X4 to R5 to X4 In 1 patient HIV ‚shifted‘ from R5 to X4 to R5
- In Motivate Studies 8% switched between screening and start of
MVC-Therapy
Genotyping results
Presentation in Dublin from the “ANRS” - group: Cathia Soulié, Anne Derache, Catherine Aimé, Anne-Geneviève Marcelin, Guislaine Carcelain, Anne Simon, Christine Katlama, Vincent Calvez
- Successful Amplifikation in 83,1% of n=69 patients samples
- Interpretation with geno2pheno in 66/69 cases, with PSSM in 58/69
cases (No Alignment Tool in PSSM) „mean of both systems“ ART naive: R5 71,2%, X4 28,8% ART experienced R5 58,8%, X4 41,2%
- Comparable numbers with results from phenotyic studies?
Percentage of HIV Co-receptor Usage
Study/Source Population N Homer cohort1 Naive 979 C & W cohort2 Naive 402 81% <1% 19% TORO 1/24 Experienced 612 62% 4% 34% ViroLogic5 Experienced >2000 48% 2% 50% ACTG 52116 Experienced 391 49% 4% 47% Demarest3 Naive 299 88% 0% 12% 82% <1% 18% R5 X4 R5/X4
1Brumme ZL, et al. J Infect Dis. 2005;192:466-474. 2Moyle GJ, et al. J Infect Dis. 2005;191:866-872. 3Demarest J, et al. ICAAC 2004. Abstract H-1136.
*This table may not include all available reported data. Majority of data are generated in the developed world (subtype B)
4Whitcomb JM, et al. CROI 2003. Abstract 557. 5Paxinos EE, et al. ICAAC 2002. Abstract 2040. 6Wilkin T, et al. CROI 2006. Abstract 655.
Phenotypic and genotypic tests came to comparable numbers for coreceptor usage in therapy naives and therapy-experienced patient cohorts
Minorities do they always exist? Do they always play a clinicilly relevant role?
Are Coreceptor blockers dangerous and drive coreceptor switch?
MOTIVATE 1 and 2: Change in CD4 Cell Count from Baseline by Tropism Result at Time of Failure
Mean change in CD4 count from baseline, cells/mm3 in patients with treatment failure Tropism result, Baseline → Treatment Failure Placebo + OBT N = 209 MVC QD + OBT N = 414 MVC BID + OBT N = 426 All treatment failures +14 (n = 97) R5 → R5 +15 (n = 80) +61 (n = 18) +138 (n = 17) +67 (n = 4) +49 (n = 68) +71 (n = 77) R5 → D/M or X4 +37 (n = 31) +56 (n = 32)
- Approximately 8% of patients had a change in tropism result between screening and
baseline, demonstrating the change in background tropism over a 4–6 week period in this population
- Response to maraviroc treatment in these patients was consistent with the results
- f study A4001029 in patients with D/M-tropic virus (XVI IAC 2006, Abs THLB0215)
Data excludes patients who had no tropism result at time
- f failure and patients with non-R5 virus at baseline
MOTIVATE 1 & 2-Week 24
Resistance to Coreceptor blockers?
HIV-1 isolate from a Δ32/wt CCR5 patient with unusual broad coreceptor usage
Gorry et al., Virology, Jan 2007
region
V1 V2 V3 C4 isolate
unusual long region Y308 I317 D321 K442 E444
(compensatory)
Mutations under MVC pressure during cell culture passage
Passage V1 V2 V3 C3 C4 V4
CC1/ 85
CTRPNNNTRKSI HI GPGRAFYTTGDI I GDI RQAHC
st art T163 A316 T319 I323I/ V N335N/ P/ K/ Y S405S/ A/ T/ Esuscept ible number 16 T163K A316T/ S T319T/ S I323V N355Y S405A resistent revert ant A316 I323V suscept ible RU570
CTRPNNNTRKSI SFGPGQAI YTTGNI I GDI RQAHC
st art S132 QAI 315- 317 T319 N322 suscept ible number 18 (8) S132N ΔQAI N322D N442K D389N resistent number 18 (2) N322D suscept ible revert ant T319K/ T N322D suscept ible
Westby et al., Journal of Virology, Mar. 2007
Clinical data that may improve the prediction
Comparison of genotypic and or phenotypic data see Posters #53 N. Chueca and #82 E. Poveda Minorities are there but not always a problem X4 under immune control? We canot simply transfer our tools from RT- and Protease resistance to coreceptor prediction tools
Institute of Virology, University of Cologne Martin Däumer Saleta Sierra-Aragon Eva Heger Claudia Müller Dörte Hammerschmidt Jens Verheyen Ibrahim Boussaad Eugen Schülter Herbert Pfister Rolf Kaiser MPI for Informatics, Saarbrücken Tobias Sing Achim Buech Andre Altmann Alexander Thielen Oliver Sander Thomas Lengauer
- Dept. of Mathematics, UC Berkeley, CA, USA
Niko Beerenwinkel University of Essen; caesar, Bonn Daniel Hoffmann caesar, Bonn Ulrike Schuldenzucker MPl of Molecular Plant Physiology, Golm Joachim Selbig Institute of Clinical and Molecular Virology, German National Reference Center for Retroviruses, University of Erlangen-Nürnberg Barbara Schmidt Hauke Walter Klaus Korn
- Dept. of Gastroenterology, University of Düsseldorf
Mark Oette
- Dept. of Internal Medicine I, University of Cologne
Gerd Fätkenheuer Clara Lehmann
- Dept. of Internal Medicine I, University of Bonn
Jürgen Rockstroh Medical Laboratory, Berlin Thomas Berg PZB, Aachen Heribert Knechten, Patrick Braun and the Resina study group
geno2pheno
www.geno2pheno.org / www.genafor.org
Collaborative Trials for Phenotypic Assays Collaborative Trials for Genotypic Assays => ENVA?
TG_66
day 0
TG_66
day 28
TG_66
day 56
TG_66
3068 3164 3015
- X4-Virus as minor variant at day 0.
- Day 0 sample showed a T215D revertant
- Primary resisant virus
TG_66
SI/NSI phenotype
- Calculate the overall charge of the V3 peptide:
if V3-charge > +4 ⇒ SI (64/11) if V3-charge ≤ +4 ⇒ NSI (125/11)