AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Correlations between transmitted HIV-1 drug resistance mutations and - - PowerPoint PPT Presentation
Correlations between transmitted HIV-1 drug resistance mutations and - - PowerPoint PPT Presentation
Correlations between transmitted HIV-1 drug resistance mutations and the HLA of therapy- naive HIV-patients AREVIR - Meeting 10./11.04.2008 Finja Schweitzer Background: Immune Pressure immune escape mutants AREVIR - Meeting 10./11.04.2008
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Background: Immune Pressure
immune escape mutants
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Background: Drug Pressure
Genotypic resistance testing:
Identification of drug resistance mutations Adjustment of therapy
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Research Problem
including drug resistance mutations
10% of therapy-naive patients already hold drug resistance mutations!!!
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Hypothesis
Drug Resistance Mutation = Escape Variants
Previous Statistical Analysis:
Correlations of HLA-A & -B and drug resistance mutations
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Results of Statistical Analysis
Confirm statistically obtained results by means of an
biological assay: ELISPOT
Samples of each indicated group
Drug resistance mutation HLA class I type P value
L33F HLA-A* 01 & B* 35 0.0125 M46I/L HLA-A* 03 & B* 35 0.0109 V75I HLA-A* 11 0.0323 K103R HLA-B* 44 0.0018 V118I HLA-B* 07 & B* 40 0.0344 L210F HLA-B* 44 0.0074
protease
Reverse transcriptase
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Principle: ELISPOT
viral peptide interferon-γ PBMC EDTA blood
- 2. Recruitment of Patients
- 1. Design of Peptides
- 3. ELISPOT assay
2 weeks incubation restimulation
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
- 1. Design of Peptides: WT
- Search databases for (potential) HLA restricted CTL
epitopes for 6 amino acid positions
- Design overlapping WT peptides (length: 15AA) in order
to confirm epitopes
- eg. 33
KEALLDTGADDTVLEEMSLPGRWKPKMIGGI
20 30 40 50 B*35 (potential) A*01
Peptide Sequence
Pol07-20 EALLDTGADDTVLEE Pol07-21 DTGADDTVLEEMNLP Pol07-22 DDTVLEEMNLPGRWK Pol07-23
LEEMNLPGRWKPKMI
required motifs: HLA-A* 01: . . [DE] . . . . . [Y] HLA-B* 3501: . [PAV] . . . . . . . HLA-B* 3501: . [PAVYRD] . . . . . . [YFMLI]
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
- 1. Design of Peptide: Mutant
- Design of mutant peptide (length: 10AA)
according to patients amino acid substitutions
e.g. described epitope at amino acid position 210
TKIEELRQHLLRWGLTTPDKK
200 210 220 B*44
Peptide Sequence
Negative control
- L210
EELRQHLLRW L210W EELRQHLWRW L210F EELRQHLFRW Positive control PHA
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
- 2. Recruitment of Patients
- 75 patients in statistical analysis
19 with corresponding HLA types and drug
resistance mutation
- Problems, recruiting patients:
patients come from different clinics blood needs to be processed within 48h cells cannot be frozen and stored before ELISPOT
(5 samples lost)
cells cannot be cultured longer than 24h before
ELISPOT
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
- 3. Detail ELISPOT: assay
coat plate with antibody incubate overnight Cells with or without (control) peptide add biotinylated antibody add streptavidin enzyme add substrate (AEC) to develop spots
Previous step: 2 weeks incubation
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
ELISPOT Result: L210F
negative control L210 L210W L210F positive control
ID 663 2,5 30 24 316,5 100 200 300 400 negative control L210F L210W L210 positive control SFU / 100000 cells
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Comparison to a „L210F“ patient from Erlangen
ID 663 2,5 30 24 316,5 100 200 300 400 negative control L210F L210W L210 positive control SFU / 100000 cells
Patient ID 16, Erlangen 48,5 94,5 524,5 359 100 200 300 400 500 600 negative control L210F L210W L210 SFU / 100000 cells
L210F:
immune escape in background of HLA-B* 44
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Result of a clinical follow up of therapy-experienced patients holding a L210F
Therapy-experienced (20):
- 8 patients show mutations of TAM pathways
68.8% TAM I 31.2% TAM II Seems to push the drug
resistance development towards the TAM-I pathway
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
ELISPOT Results: remaining amino acid positions
- 3/5 sharing only HLA-A* 01 recognized
peptide covering amino acid 33 in PR
- 6/10 HLA-A* 03: 46 PR
- 4/7 HLA-A* 11: 75 RT
Indications of epitopes within investigated
regions
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Next steps
- Further studies to confirm the presence of these
epitopes
- Investigte the influence of mutations within epitopes
- n T-cell activity
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer
Thanks to..
My colleagues at the Institute of Virology, Cologne Martin Däumer and the Laboratory Dr.Thiele, Kaiserslautern Sandra Mueller and Thomas Harrer, University of Erlangen The clinicians especially at the University Hospital Düsseldorf
AREVIR - Meeting 10./11.04.2008 Finja Schweitzer