Outline What is EMBOSS? Major programs Running EMBOSS Programs - - PDF document

outline
SMART_READER_LITE
LIVE PREVIEW

Outline What is EMBOSS? Major programs Running EMBOSS Programs - - PDF document

EMBnet Course: Unix & PERL for biomedical researchers Basel, 12 October 2006 Lorenza Bordoli Swiss Institute of Bioinformatics Outline What is EMBOSS? Major programs Running EMBOSS Programs from the Unix command line


slide-1
SLIDE 1

EMBnet Course: Unix & PERL for biomedical researchers

Basel, 12 October 2006

Lorenza Bordoli

Swiss Institute of Bioinformatics

Lorenza Bordoli EMBOSS 12 October 2006

Outline

  • What is EMBOSS?
  • Major programs
  • Running EMBOSS Programs from the

Unix command line

  • Combining EMBOSS with Perl
slide-2
SLIDE 2

Lorenza Bordoli EMBOSS 12 October 2006

What is EMBOSS ?

  • http://emboss.sourceforge.net/
  • EMBOSS, The European Molecular Biology Open Source Software Suite, is

a package of high-quality FREE Open Source software for sequence analysis;

  • EMBOSS includes hundreds of applications (+150). They share a similar

interface, but each comes with its own documentation:

  • Many sequence analysis & display programs.
  • Protein 3D structure prediction being developed.
  • Other assorted programs, eg: enzyme kinetics.
  • Extensible (with some C programming knowledge)!
  • Complete list of the programs in the currently release:

http://emboss.sourceforge.net/apps/#Overview

  • Grouped applications: http://emboss.sourceforge.net/apps/groups.html

Lorenza Bordoli EMBOSS 12 October 2006

EMBOSS !

  • Free Open Source (for most Unix platforms, including MacOSX)
  • GCG successor (compatible with GCG file format)
  • Public domain (GNU Public License)
  • Written by HGMP/Sanger/EBI/Denmark … etc
  • Easy to install locally:

but no interface, requires local databases Unix command-line only

  • Interfaces:

Jemboss, www2gcg, w2h, wEMBOSS… (with account) Pise, EMBOSS-GUI, SRS (no account) Staden, Kaptain, CoLiMate, Jemboss (local)

slide-3
SLIDE 3

Lorenza Bordoli EMBOSS 12 October 2006

EMBOSS: Introduction

  • The EMBOSS package consists of a large number of separate programs

that have a specific function.

  • They usually take a (number of) input file(s) and some parameters that are

important to the function and produce output in the form of files, plots, web pages or simple text output.

Lorenza Bordoli EMBOSS 12 October 2006

Running EMBOSS Programs

EMBOSS programs are run by:

  • typing them at the UNIX prompt: X-terminal (X window system)

Local computer Remote server: bc2-emboss01.bc2.unibas.ch

slide-4
SLIDE 4

Lorenza Bordoli EMBOSS 12 October 2006

Running EMBOSS Programs

EMBOSS programs are run by:

  • or by using an interface: web based (browser), java based

embl:m93650

Local computer Remote server: sib-dea.unil.ch

Lorenza Bordoli EMBOSS 12 October 2006

Graphical interfaces to EMBOSS

  • Jemboss: java based interface to EMBOSS
  • wEMBOSS: web interface to EMBOSS
  • Pise: web interface to EMBOSS
  • others : http://emboss.sourceforge.net/
slide-5
SLIDE 5

Lorenza Bordoli EMBOSS 12 October 2006

Access to EMBOSS: graphical interfaces http://emboss.ch.embnet.org

Access to EMBOSS: graphical interfaces

  • wEMBOSS: account needed on EMBnet machine (->ask Laurent)

http://www.bc2.unibas.ch/

EMBOSS,Jemboss/wEMBOSS: unibasel account

slide-6
SLIDE 6

Lorenza Bordoli EMBOSS 12 October 2006

Some major programs:

  • General:

wossname lists all EMBOSS programs showdb shows the available databases

  • Sequence retrieval:

seqret retrieves and/or changes format of a sequence seqretset retrieve and or change formats of a number seqretall

  • f sequences at once

transeq translate a DNA sequence to protein backtranseq translate a protein sequence to DNA extractseq extract regions from a sequence cutseq remove a region from a sequence pasteseq inserts a sequence into another sequence infoseq display information about a sequence splitter split a sequence into smaller sequences

Lorenza Bordoli EMBOSS 12 October 2006

Some major programs (cont.):

  • Sequence comparison

needle Needleman-Wusch sequence alignment water Smith-Waterman sequence alignment stretcher Myers and Miller global alignment matcher Huang and Miller local alignment dottup dotmatcher dotplot comparisons of two sequences. prettyplot plots multiple sequence alignments polydot supermatcher dotplot comparisons of multiple sequences emma ClustalW program

  • Sequence parameters

cusp generates a codon usage table syco synonymous codon usage plot dan calculates DNA/RNA melting temperature compseq sequence composition tables

slide-7
SLIDE 7

Lorenza Bordoli EMBOSS 12 October 2006

  • DNA Sequence features

remap restriction map of the sequence remap cpgplot cpgreport CpG island detection etandem einverted finds tandem and inverted repeats plotorf plots potential ORFs showorf pretty display of potential ORFs fuzznuc DNA pattern search tfscan scans sequence for TF binding sites

Some major programs (cont.):

Lorenza Bordoli EMBOSS 12 October 2006

  • Protein Sequence features

ief Isoelectric point calculation antigenic Finds potential antigenic sites digest protein digestion map findkm Vmax and Km calculations fuzzpro protein pattern search garnier protein 2D structure prediction helixturnhelix finds nucleic acid binding motifs

  • ctanol

pepwindow displays protein hydropathy patmatdb patmatmotifs searching with motifs vs protein sequences pepcoil predicts coiled coil regions pepinfo pepstats Protein information Hammer package ehmmpfam, ehmmsearch, ehmmbuild, … Phylip package efitch, edolpenny, edollop, …

Some major programs (cont.):

slide-8
SLIDE 8

Lorenza Bordoli EMBOSS 12 October 2006

Working with sequences :

  • EMBOSS reads sequences from files or databases.
  • It automatically recognizes the input sequence format.
  • You can easily specify many output formats.

Lorenza Bordoli EMBOSS 12 October 2006

Uniform Sequence Address (USA)

  • = a standard way of specifying a sequence to be read into a program in EMBOSS
  • Sequences can be in databases or in files
  • It has the following syntax:

format::database:entry format::file:entry In general, a USA specifies

  • what sequence format to expect
  • what file or database to open
  • what entry to look for
slide-9
SLIDE 9

Lorenza Bordoli EMBOSS 12 October 2006

Uniform Sequence Address (USA)

format::database:entry

  • Of these only the “file” or “database” are necessary;
  • If format is omitted: EMBOSS will check and recognizes the format (occasionally

needs a hint) * ;

  • if the “entry “ part is omitted, all of the entries in the file or database are read in;

* EMBOSS recognizes: GCG, FASTA, ClustalW, MSF, EMBL, GenBank, DNAStrider, Phylip, PIR, PAUP,ASN.1, NBRF, Fitch, IntelliGenetics

Lorenza Bordoli EMBOSS 12 October 2006

Uniform Sequence Address (USA)

The most common ways of specifying a sequence are:

  • to type the name of the file that the sequence is in: myfile.seq
  • or type “db:entry”, where “db” is the name of the database and “entry” is

either the ID or the accession number (AC) of the sequence in the database Ex.: database:accession embl:X65923 database:ID swissprot:opsd_xenla file name myfile.seq

slide-10
SLIDE 10

Lorenza Bordoli EMBOSS 12 October 2006

ACs and IDs …

  • An entry in a database: uniquely identified in that database. Most sequence

databases have two such identifiers for each sequence - an ID name and an Accession number.

  • Why are there two such identifiers?
  • The ID name: a human-readable name that had some indication of the

function of its sequence: OPSD_HUMAN in Swiss-Prot !! ID names are not guaranteed to remain the same between different versions

  • f a database.
  • Accession numbers: unique alphanumeric identifiers that are guaranteed to

remain with that sequence through the rest of the life of the database:

  • P08100. If two sequences are merged into one, then the new sequence will

get a new Accession number and the Accession numbers of the merged sequences will be retained as 'secondary' Accession numbers.

Lorenza Bordoli EMBOSS 12 October 2006

Databases

You can easily find out what are the database name in your EMBOSS installation by running the showdb program: Unix % showdb Displays information on the currently available databases #Name Type ID Qry All Comment #==== ==== == === === ======= sw P OK OK OK Swiss-Prot section of UniProt swiss P OK OK OK Swiss-Prot section of UniProt swiss-prot P OK OK OK Swiss-Prot section of UniProt trembl P OK OK OK TrEMBL section of UniProt uniprot P OK OK OK UniProt (Swiss-Prot & TrEMBL), …

slide-11
SLIDE 11

Lorenza Bordoli EMBOSS 12 October 2006

Databases

#Name Type ID Qry All Comment #==== ==== == === === ======= sw P OK OK OK Swiss-Prot section of UniProt

  • ID allows programs to extract a single explicitly named entry from the database:

embl:x13776 ;

  • Query indicates that programs can extract a set of matching wildcard entry

names: sw:opsd_* ;

  • All allows programs to analyze all entries in the database sequentially: embl:*

;

Lorenza Bordoli EMBOSS 12 October 2006

Uniform Sequence Address (USA)

  • you may also use:

filename all sequences in a file filename:entry an entry in a file dbname all sequences in a database (not recommended) dbname:entry a sequence in a database @listfile a list file list::listfile a list file asis::sequence a specific short sequence

slide-12
SLIDE 12

Lorenza Bordoli EMBOSS 12 October 2006

Specifying a List File

  • Instead of containing the sequences themselves, a listefile contains

“references” to sequences using any valid USA.

  • Example of a ListFile:
  • psd_abyko.fasta

: the name of a sequence file; sw:opsd_xenla : a specific sequence in the Swiss-Prot database; @anotherlist : the name of a second list file;

  • Blank lines and lines starting with a '#' character are ignored in List Files: a way to

add your comments: this won’t be read by the programs.

#This is an example #of a list file

  • psd_abyko.fasta

sw:opsd_xenla @anotherlist

Lorenza Bordoli EMBOSS 12 October 2006

Specifying a sequence “As Is”

  • The simplest USA format is “asis” format. This is used to specify a sequence

immediately without it having to be in a file or a database.

  • The syntax is “asis::sequence”:

asis::atgctagcttagc : for the sequence “atgctagcttagc” ;

slide-13
SLIDE 13

Lorenza Bordoli EMBOSS 12 October 2006

Sequence Formats

  • Sequences can be read and written in a variety of formats;
  • Sequences are stored in databases or in files as simple text (ASCII text);
  • Microsoft WORD format is not a sequence format (save the file as text *.txt file!!!)
  • The default sequence file format is fasta:

>xyz some other comment ttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgc agctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcg cccagatcaaggctcatgtagcctcactggagggcatt xyz: ID name

  • Sequence Database Format: EMBL, GenBank, SwissProt, PIR;
  • Sequence File: Files can hold sequences in standard recognized formats;

Lorenza Bordoli EMBOSS 12 October 2006

Sequence Formats

  • Currently input/output supported formats (more than 42):

http://emboss.sourceforge.net/docs/themes/SequenceFormats.html

  • Input Sequence Formats: fasta, EMBL (embl/em), Swiss-Prot

(swissprot/swiss/sw), GCG (gcg), MSF (msf), Genbank (genbank), raw,…

  • Output Sequence Formats: embl, gcg, swiss, CLUSTALW (clustal, aln), genbank,

slide-14
SLIDE 14

Lorenza Bordoli EMBOSS 12 October 2006

Running EMBOSS from the Unix command line

Lorenza Bordoli EMBOSS 12 October 2006

The command Line

  • EMBOSS programs are called by giving their name on the UNIX command line

either:

  • without parameters: interactive way, query-answer session with the user, in

which the user is asked (prompted) to enter a piece of information one at a time;

  • or with parameters: the program will have all the information it needs all at
  • nce;
slide-15
SLIDE 15

Lorenza Bordoli EMBOSS 12 October 2006

The command Line

  • EMBOSS programs are called by giving their name on the UNIX command line:
  • without parameters: interactive way, query-answer session with the user,

in which the user is asked (prompted) to enter a piece of information one at a time: % seqret Reads and writes (returns) a sequence Input sequence: embl:ab001020 Output sequence [ab001020.fasta]: % more ab001020.fasta >AB001020; AB001020 Schizosaccharomyces pombe mRNA encoding 42 a.a. protein, complete cds. atcttttttgtaaaatcggttttttaaaatttgtaatttcccccaaacccggtaccttga taccgcaaggataagttggaaagcgagttgcagttgtctacgtgacggtgcttgactccg actttttagctatcctttagcagatttgaaaggagagttgaaggattttttcttttctct

Lorenza Bordoli EMBOSS 12 October 2006

The command Line

  • EMBOSS programs are called by giving their name on the UNIX command line:
  • without parameters: interactive way, query-answer session with the user,

in which the user is asked (prompted) to enter a piece of information one at a time: % wossname Finds programs by keywords in their one-line documentation Keyword to search for: restrict SEARCH FOR 'RESTRICT’ recode Remove restriction sites but maintain the same translation remap Display a sequence with restriction cut sites, translation Etc…

slide-16
SLIDE 16

Lorenza Bordoli EMBOSS 12 October 2006

The file “stdout”

  • Note that the default output file for wossname is:

stdout (Standard output)

  • Use this whenever prompted for an output file.
  • This is a ‘magic’ file name.
  • It displays the output on the screen, not a file.

Lorenza Bordoli EMBOSS 12 October 2006

The command Line

  • EMBOSS programs are called by giving their name on the UNIX command line:
  • with parameters: the program will have all the information it needs all at
  • nce:
  • % seqret -sequence filename.seq -outseq xlrhodop.fasta
  • programname
  • parameter/object: here: a sequence file
  • qualifier: specify the properties of that object/parameter. here: input/output

sequence

slide-17
SLIDE 17

Lorenza Bordoli EMBOSS 12 October 2006

The command Line and parameters

% seqret -sequence filename.seq -outseq xlrhodop.fasta programname parameter/object: here: a sequence file qualifier: specify the properties of that object/parameter. here: input/output sequence

  • There are 3 classes of parameters:
  • standard (mandatory) : minimum input for the program, the program will

prompt for them; ex: sequence file name;

  • additional (optional) : you will be prompted only if you use the –options

(-opt) qualifier; ex: begin and end of the sequence;

  • advanced : you have to specify them on the command line (you won’t be

prompted);

Lorenza Bordoli EMBOSS 12 October 2006

The command Line and parameters

  • There are 3 classes of parameters:
  • standard (mandatory) : minimum input for the program, the program will

prompt for them; ex: sequence file name;

  • additional (optional) : you will be prompted only if you use the –options

qualifier; ex: begin and end of the sequence;

  • advanced : you have to specify them on the command line (you won’ be

prompted);

  • How do I find them out? With the –help qualifier! (try also –verbose)

% Programname -help

slide-18
SLIDE 18

Lorenza Bordoli EMBOSS 12 October 2006

Qualifiers

% seqret –help (-verbose) Mandatory qualifiers: [-sequence] seqall Specify a sequence Optional qualifiers: none Advanced qualifiers:

  • feature

boolean

Lorenza Bordoli EMBOSS 12 October 2006

"-sequence" related qualifiers

  • sbegin

integer first base used

  • send

integer last base used, def=seq length

  • sreverse

bool reverse (if DNA)

  • sask

bool ask for begin/end/reverse

  • slower

bool make lower case

  • supper

bool make upper case

  • sformat

string input sequence format

slide-19
SLIDE 19

Lorenza Bordoli EMBOSS 12 October 2006

"-outseq" related qualifiers

  • osformat

string output sequence format

  • ossingle

bool separate file for each entry

Lorenza Bordoli EMBOSS 12 October 2006

Qualifiers: Example

% seqret –sequence sw:P80590 -outseq P80590.fasta

>LHB1_RHOTE P80590 Light-harvesting polypeptide B-885 beta- 1 chain (LH-1) (Antenna pigment polypeptide beta-1 chain). AEDRKSLSGLTEQEAQEFGTLYTQGVAFVAVIAVVAHALVWAWRPWLQ % seqret –sequence sw:P80590 -outseq P80590_sh.fasta -sbegin1 1 -send1 10 >LHB1_RHOTE P80590 Light-harvesting polypeptide B-885 beta-1 chain (LH-1) (Antenna pigment polypeptide beta-1 chain). AEDRKSLSGL

slide-20
SLIDE 20

Lorenza Bordoli EMBOSS 12 October 2006

Boolean options (Yes/No, True/False)

  • thing, -nothing
  • -thing=T, -thing=F
  • -thing=1, -thing=0
  • -thing=Y, -thing=N

Lorenza Bordoli EMBOSS 12 October 2006

General qualifiers

  • These can be used with any program:
  • help

Prints a summary of the options the program can take. With

  • verbose it gives a more detailed list.
  • options

Prompt the user for the optional parameters

  • auto

Accept all the default settings and run without prompting the user (used when running program scripts)

  • sask

Ask for the start, end and reverse of the sequence input

  • stdout

Print output to stdout (the screen) instead of to a file.

  • filter

Take input from stdin (keyboard) and output to stdout

  • warnings

Report warnings

  • error

Report errors

slide-21
SLIDE 21

Lorenza Bordoli EMBOSS 12 October 2006

Example: Seqret

  • Give seqret all of its data on the command-line :

% seqret embl:ab001020 -outseq ab001020.fasta % seqret embl:ab001020 ab001020.fasta

  • Even shorter, leave out the qualifier:

% seqret -help -verbose

Lorenza Bordoli EMBOSS 12 October 2006

Example: Seqret

  • seqret can reformat sequences by specifying the output format:

% seqret embl:ab001020 –osformat gcg -outseq ab001020.gcg % seqret embl:ab001020 ab001020.gcg –osformat gcg

  • equivalent to:

% seqret embl:ab001020 gcg::ab001020.gcg Unix % more ab001020.gcg !!NA_SEQUENCE 1.0 Schizosaccharomyces pombe mRNA encoding 42 a.a. protein, complete cds. AB001020; Length: 969 Type: N Check: 8777 .. 1 atcttttttg taaaatcggt tttttaaaat ttgtaatttc ccccaaaccc 51 ggtaccttga taccgcaagg ataagttgga aagcgagttg cagttgtcta

  • equivalent to:
slide-22
SLIDE 22

Lorenza Bordoli EMBOSS 12 October 2006

Uniform Sequence Address (USA)

  • = a standard way of specifying a sequence to be read into a program in EMBOSS
  • Sequences can be in databases or in files
  • It has the following syntax:

format::database:entry In general, a USA specifies

  • what sequence format to expect
  • what file or database to open
  • what entry to look for

Lorenza Bordoli EMBOSS 12 October 2006

Databases

#Name Type ID Qry All Comment #==== ==== == === === ======= sw P OK OK OK Swiss-Prot section of UniProt

  • ID allows programs to extract a single explicitly named entry from the database:

embl:ab001020 ;

  • Query indicates that programs can extract a set of matching wildcard entry

names: sw:opsd_* ;

  • All allows programs to analyze all entries in the database sequentially: embl:*

;

slide-23
SLIDE 23

Lorenza Bordoli EMBOSS 12 October 2006

Asterisk on the command line

  • You can't use a ‘*’ on the UNIX command-line.
  • UNIX tries to match it to filenames.
  • Use it quoted, either with quotes or a backslash:

"embl:*" embl:\*

  • For example:

% seqret “sw:*_HUMAN” Human.seq % seqret sw:\*_HUMAN Human.seq

Lorenza Bordoli EMBOSS 12 October 2006

The full USA syntax

filename : a file containing one or more sequences filename:entry : a given sequence in the file. The ‘entry’ mysequences:opsd_xenla is the ID or AC of the sequence in that file filename:entry[start:end] : a part of the sequence can be specified mysequences:opsd_xenla[1:20]* by the range mysequences:opsd_xenla[-1:-20]* : the last 20 residues/nucleotides mysequences:[1:20:r]* : reverse-complemented (nucleotide sequences) * In some Unix shell you might have to use backslash: \[ and \[

slide-24
SLIDE 24

Lorenza Bordoli EMBOSS 12 October 2006

The full USA syntax: summary

  • The full syntax of the possible USAs are:

Mandatory parts of the USAs are given in bold text. asis :: Sequence [start : end : reverse] format :: '@' ListFile [start : end : reverse] format :: 'list' : ListFile [start : end : reverse] format :: Database : Entry [start : end : reverse] format :: Database - SearchField : Word [start : end : reverse] format :: File : Entry [start : end : reverse] format :: File : SearchField : Word [start : end : reverse]

Lorenza Bordoli EMBOSS 12 October 2006

Sequence Formats

  • Currently input/output supported formats (more than 42):

http://emboss.sourceforge.net/docs/themes/SequenceFormats.html

  • Input Sequence Formats: fasta, EMBL (embl/em), Swiss-Prot

(swissprot/swiss/sw), GCG (gcg), MSF (msf), raw,…

  • Output Sequence Formats: embl, gcg, swiss, CLUSTALW (clustal, aln), …
slide-25
SLIDE 25

Lorenza Bordoli EMBOSS 12 October 2006

Multiple sequences, single file

  • EMBOSS writes many sequences to a single file. Most sequence formats can

deal with this: Fasta, EMBL, PIR, MSF, Clustal, Phylip, etc. BUT NOT: Plain, Staden and GCG

  • EMBOSS reads many sequences from a single file.

Use filename:entryname if you wish to specify a single sequence. If there is only one sequence, or you wish to read all entries, use just the filename.

Lorenza Bordoli EMBOSS 12 October 2006

Multiple sequences, many files

  • The command-line qualifier “-ossingle” my be useful – it allows you to write out

several sequences, but it writes out each sequence to a separate file;

  • The name of the file is constructed from the ID name of the sequence and the

extension of the file is the format:

  • Ex. : The sequence with the ID name “IXI_567” in fasta format would be written to

the file “IXI_567.fasta” % seqret “embl:hsf*” –ossingle

  • The program seqretsplit will split an existing multiple sequence file into many

files.

slide-26
SLIDE 26

Lorenza Bordoli EMBOSS 12 October 2006

Alignment output Formats

  • Several formats have been written or adopted for EMBOSS output:

http://emboss.sourceforge.net/docs/themes/AlignFormats.html

  • Multiple sequence alignment: fasta, msf,..
  • Pair-wise alignment: pair, score,…
  • Each program that writes an alignment has a default alignment format defined for

that program. However you can change the output formats with the “ –aformat” qualifier: % water –aformat msf

Lorenza Bordoli EMBOSS 12 October 2006

Feature Formats

  • A feature is a region of interest in a specified nucleic or protein sequence. It has a

specified start and end position. It has a name describing what type of thing it is: Ex: Swiss-Prot Feature table

FT DISULFID 3 40 FT DISULFID 4 32 FT DISULFID 16 26 FT VARIANT 22 22 P -> S (IN ISOFORM SI). FT VARIANT 25 25 L -> I (IN ISOFORM SI).

  • When reading or writing features associated with a sequence, there are a

standard set of formats that are used: UFO (Universal Feature Object) e.g. Swiss- Prot (swissprot), EMBL (embl), PIR (pir),… http://emboss.sourceforge.net/docs/themes/FeatureFormats.html

  • showfeat useful for displaying features.
  • etractfeat useful for extracting the sequences of features.
slide-27
SLIDE 27

Lorenza Bordoli EMBOSS 12 October 2006

Feature Formats

  • Many programs will read in and use the feature table of an input sequence.

Amongst these are diffseq, extractfeat, maskfeat, seqret, showfeat

  • The feature table can be already a part of the sequence (which is generally the

case when you are reading the sequence from a database) or located in a separate file

  • Try the difference between:

% seqret sw:P15423 -osformat swiss –outseq stdout % seqret sw:P15423 -osformat swiss –outseq stdout -feature

Lorenza Bordoli EMBOSS 12 October 2006

Report Formats

  • There are many ways in which the results of an analysis can be reported:

http://emboss.sourceforge.net/docs/themes/ReportFormats.html

######################################## # Program: garnier # Rundate: Mon Feb 11 15:14:40 2002 # Report_file: report.dbmotif ######################################## #======================================= # # Sequence: 100K_RAT from: 1 to: 889 # HitCount: 206 # # DCH = 0, DCS = 0 # # Please cite: # Garnier, Osguthorpe and Robson (1978) J. Mol. Biol. 120:97-120 #--------------------------------------- # # Residue totals: H:364 E:149 T:191 C:185 # percent: H: 41.7 E: 17.1 T: 21.9 C: 21.2 # # #---------------------------------------

slide-28
SLIDE 28

Lorenza Bordoli EMBOSS 12 October 2006

Report Formats

  • Many EMBOSS programs are now able to output their results in a standard report

format - you can change the report format used by putting '-rformat name' on the command-line, where 'name' is the name of one of the standard report formats.

  • examples:

embl Writes a report in EMBL feature table format pir Writes a report in PIR feature table format swiss Writes a report in SwissProt feature table format excel This is a TAB-delimited table format suitable for reading into spread-sheet programs such as Excel. seqtable A simple table format that includes the feature sequence Start End [tagnames] Sequence [start] [end] [tagvalues] [sequence]

Lorenza Bordoli EMBOSS 12 October 2006

Graphic Formats

  • -graph
  • output as X11 (default), PNG, ps, tektronics amongst other
  • CAVEAT: X11 default output doesn’t work with the X-terminal from a PC or Mac,

use “ps” instead. ps files can be opened with the Unix program gs. Or save the

  • utput as PNG. PNG files can be opened from PC or Mac.
  • Ex. % plotorf embl:ab001020
  • Plot potential open reading frames
slide-29
SLIDE 29

Lorenza Bordoli EMBOSS 12 October 2006

Example: plotorf

  • Ex. % plotorf embl:AB001020 –graph PNG

Plot potential open reading frames

Lorenza Bordoli EMBOSS 12 October 2006

Graphic Formats

[X] x11 Output to an X-window postscript Output to a postscript file (good for printing on a laser printer) cps Output to a color postscript file text Output to a text file data Output XY data points to a file. (good for importing into a graphing package) [P] png Output to a PNG image file (good for web pages) [X] Tek Output to tektronics terminal [X] xterm Output to an Xterm window [X]- requires X-windows [P] – requires PNG support The default filename is prog.format eg. octanol.ps

slide-30
SLIDE 30

Lorenza Bordoli EMBOSS 12 October 2006

The file “stdout”

  • There is a “magic” filename that you can give whenever an output filename is

request: “stdout”;

  • If you enter this name, then the resulting sequence will not go to a file called “stdout”,

BUT it will be printed on the screen;

  • Useful when you wish to know the results immediately, or are testing various way of

running a program and wish to quickly see the results

  • You can specify the output to the screen by “format::stdout”: gcg::stdout

Lorenza Bordoli EMBOSS 12 October 2006

Send the output of a program as input for a second program

% seqret embl:AB001020\[251:379\] -stdout -auto | transeq –filter

  • stdout

Print output to stdout (the screen) instead of to a file.

  • filter

Take input from stdin (keyboard) and output to stdout

  • auto

Accept all the default settings and run without prompting the user

slide-31
SLIDE 31

Lorenza Bordoli EMBOSS 12 October 2006

embedded in a single Perl script

Combining EMBOSS with Perl

program2 program1

input

  • utput

Parsed

  • utput/input

Lorenza Bordoli EMBOSS 12 October 2006

Combining EMBOSS with Perl

How to run an external programs from a Perl script? 1) System function: launches a child process which run a program:

system (“seqret embl:xlrhodop –outseq xlrhodop.fasta –auto”);

⇒ Perl waits for it to finish, then possibly grabs its output. 2) Processes as Filehandles: launches a child process that stays alive, communicating via pipes to Perl until the task is complete:

  • pen (SEQRET, “ seqret embl:xlrhodop –auto |” );

my @sequence = <SEQRET>; …

⇒ These filehandles “contains” the output of the launched command.

slide-32
SLIDE 32

Lorenza Bordoli EMBOSS 12 October 2006

Combining EMBOSS with Perl: an example: cirdna

Draws circular maps of DNA constructs

Start 1001 End 4270 group label Block 1011 1362 3 ex1 endlabel label Tick 1610 8 EcoR1 endlabel label Block 1647 1815 1 endlabel label Tick 2459 8 BamH1 endlabel label Block 4139 4258 3 ex2 endlabel endgroup group label Range 2541 2812 [ ] 5 Alu endlabel label Range 3322 3497 > < 5 MER13 endlabel endgroup

0 "BLACK", 1 "RED", 2 "YELLOW", 3 "GREEN", …

Lorenza Bordoli EMBOSS 12 October 2006 ######################################## # Program: restrict # Rundate: Sat Feb 26 21:53:07 2005 # Report_format: table # Report_file: ab014641.restrict ######################################## #======================================= # # Sequence: AB014641 from: 1 to: 3417 # HitCount: 9 # # Minimum cuts per enzyme: 1 # Maximum cuts per enzyme: 1 # Minimum length of recognition site: 4 # Blunt ends allowed # Sticky ends allowed # DNA is circular # Ambiguities allowed # #======================================= Start End Enzyme_name Restriction_site 5prime 3prime 5primerev 3primerev 1 8 NotI GCGGCCGC 2 6 . . 556 561 PvuI CGATCG 559 557 . . 856 861 Eco31I GGTCTC 862 866 . . 1335 1331 BcefI ACGGC 1317 1318 . . 1998 2003 XhoI CTCGAG 1998 2002 . . 2170 2175 HindII GTYRAC 2172 2172 . . 2680 2685 BclI TGATCA 2680 2684 . . 2918 2923 BamHI GGATCC 2918 2922 . . 3412 3417 HindIII AAGCTT 3412 3416 . . #--------------------------------------- #---------------------------------------

restrict

Finds restriction enzyme cleavage sites

Cloning vector pGEX-PUC-3T

slide-33
SLIDE 33

Lorenza Bordoli EMBOSS 12 October 2006

restrict parsed output

Start 1 End 3417 group label Tick 1 8 NotI endlabel label Tick 556 8 PvuI endlabel label Tick 856 8 Eco31I Endlabel (...) label Tick 2918 8 BamHI endlabel label Tick 3412 8 HindIII endlabel endgroup

Lorenza Bordoli EMBOSS 12 October 2006

cirdna.pl

#!/usr/local/bin/perl #perl script to 1. parse the output of the EMBOSS program "restrict" which uses #the REBASE database of restriction enzymes to predict cut sites in a DNA sequence. #2. write a input file for the EMBOSS program "cirdna" and 3. run the "cirdna" #program which draws circular maps od DNA construct use strict; use warnings; #if no filename is specified on the command-line print USAGE and exit #the file should contain a DNA sequence in one of the EMBOSS recognized formats my $USAGE=" SYNOPSIS $0 filename\n"; unless (@ARGV){ print $USAGE ; exit; } #Read in the filename from the argument on the command line my $filename=$ARGV[0];

slide-34
SLIDE 34

Lorenza Bordoli EMBOSS 12 October 2006

cirdna.pl

#write the parsed output of the "restrict program" in a file my $inputfile = "$filename.restrict"; unless (open(OUT, ">$inputfile")){ print " Could not open file $inputfile! to write to !! \n\n"; exit; }

Lorenza Bordoli EMBOSS 12 October 2006

cirdna.pl

#launch the emboss program "restrict" to do a restriction analysis of #the DNA #the maximum number of cuts for any restriction enzyme that will be #considered is set to 1 #a list of enzymes is provided and we specify that the DNA is circular #the command is: #"restrict filename -enzymes HindIII,XhoI -max=1 -plasmid=Y -auto #-stdout"

  • pen (RESTRICT, "restrict $filename -enzymes NotI,PvuI -max=1
  • plasmid=Y -auto -stdout |");
slide-35
SLIDE 35

cirdna.pl

#Read the output in a "while" loop and extract the start and the #beginning of the DNA sequence #and the start, the end and the name of the restriction enzyme my $line; while ($line = <RESTRICT> ) { chomp($line); #regular expression to match start and the end of the sequence if ($line =~ /^#\sSequence.*from:\s+(\d+).*to:\s+(\d+)/){ my ($seqstart, $seqend) = ($1, $2); #print the DNA start and the beginning in the input file print OUT "Start\t$seqstart\nEnd\t$seqend\n\ngroup\n"; } #regular expression to match start, end and name of the enzyme if ($line =~ /^\s+([0-9]+)\s+([0-9]+)\s+(\w+)\s+/){ my ($start,$end,$enzyme) = ($1,$2,$3); print OUT "label\nTick\t$start\t8\n$enzyme\nendlabel\n"; } } print OUT "endgroup"; close (OUT);

Lorenza Bordoli EMBOSS 12 October 2006

cirdna.pl

#launch the emboss program "cirdna" to draw a circular maps od DNA #the command is: "cirdna inputfile –goutfile outputfile -graph ps -auto" my $cmd="cirdna $inputfile -goutfile $filename -graph ps -auto"; system ("$cmd"); exit;

slide-36
SLIDE 36

Lorenza Bordoli EMBOSS 12 October 2006

restrict parsed output

Start 1 End 3417 group label Tick 1 8 NotI endlabel label Tick 556 8 PvuI endlabel label Tick 856 8 Eco31I Endlabel (...) label Tick 2918 8 BamHI endlabel label Tick 3412 8 HindIII endlabel endgroup

pGEX-PUC-3T.restrict

Lorenza Bordoli EMBOSS 12 October 2006

cirdna.pl output

pGEX-PUC-3T.ps

  • utput file
slide-37
SLIDE 37

Lorenza Bordoli EMBOSS 12 October 2006

lindna

Lorenza Bordoli EMBOSS 12 October 2006

Reminder if you are lost

  • If in doubt, use:

wossname program –help -verbose program -opt tfm program The friendly manual ;)

slide-38
SLIDE 38

Lorenza Bordoli EMBOSS 12 October 2006

References

  • http://emboss.sourceforge.net/
  • UK HGMP Resource Centre, Userguide, 2002
  • www.perl.org